PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn305801
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 132aa    MW: 14539.8 Da    PI: 5.6019
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn305801genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26055.32e-17227547100
      DUF260  47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  +lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lq+q++ l+++la++++e
  Achn305801  22 IELPVHQRGDAVSSMVYEANARVRDPVYGCVGSISSLQHQIDVLQTQLAMAQAE 75 
                 56899********************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.25176IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-162373IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MITVADIFFM LIMIIMAKGK MIELPVHQRG DAVSSMVYEA NARVRDPVYG CVGSISSLQH  60
QIDVLQTQLA MAQAEVVHLR MRQFSSTSGR PTTTSPENRS PPPVPISQTK SPFNMDMVVD  120
EPSIEESLWS C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364248.18e-49PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE93e-32LBD4_ARATH; LOB domain-containing protein 4
TrEMBLM1AGH39e-49M1AGH3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000222862e-48(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-31LOB domain-containing protein 4